r2016b statistics toolbox release 2016b Search Results


97
MathWorks Inc r 2016b global optimization toolbox
R 2016b Global Optimization Toolbox, supplied by MathWorks Inc, used in various techniques. Bioz Stars score: 97/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/r2016b+statistics+toolbox+release+2016b/10__1080_slash_0305215x__2020__1722118-174-21-20?v=MathWorks+Inc
Average 97 stars, based on 1 article reviews
r 2016b global optimization toolbox - by Bioz Stars, 2026-07
97/100 stars
  Buy from Supplier

96
MathWorks Inc matlab r 2016b
Matlab R 2016b, supplied by MathWorks Inc, used in various techniques. Bioz Stars score: 96/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/r2016b+statistics+toolbox+release+2016b/pm30560303-93-10-13?v=MathWorks+Inc
Average 96 stars, based on 1 article reviews
matlab r 2016b - by Bioz Stars, 2026-07
96/100 stars
  Buy from Supplier

N/A
Mouse monoclonal Cytokeratin 4+5+6+8+10+13+18 antibody (FITC)
  Buy from Supplier

N/A
A synthetic peptide for use as a blocking control in assays to test for specificity of Sec31a antibody, catalog no. 70R-9307
  Buy from Supplier

N/A
Recombinant human AK5 protein (His tag)
  Buy from Supplier

N/A
Transportin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVQKTLAQAMMYTQHPEQYEAPDKDFMIVALDLLSGLAEGLGGHVEQLVA. Rabbit polyclonal Transportin 2 antibody.
  Buy from Supplier

N/A
Rabbit polyclonal LCN2 antibody (biotin)
  Buy from Supplier

N/A
Rabbit polyclonal NFKB-p65 antibody
  Buy from Supplier

N/A
ELISA Kit for detection of IL6 in the research laboratory
  Buy from Supplier

Image Search Results