97
|
MathWorks Inc
r 2016b global optimization toolbox R 2016b Global Optimization Toolbox, supplied by MathWorks Inc, used in various techniques. Bioz Stars score: 97/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/r2016b+statistics+toolbox+release+2016b/10__1080_slash_0305215x__2020__1722118-174-21-20?v=MathWorks+Inc Average 97 stars, based on 1 article reviews
r 2016b global optimization toolbox - by Bioz Stars,
2026-07
97/100 stars
|
Buy from Supplier |
96
|
MathWorks Inc
matlab r 2016b Matlab R 2016b, supplied by MathWorks Inc, used in various techniques. Bioz Stars score: 96/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/r2016b+statistics+toolbox+release+2016b/pm30560303-93-10-13?v=MathWorks+Inc Average 96 stars, based on 1 article reviews
matlab r 2016b - by Bioz Stars,
2026-07
96/100 stars
|
Buy from Supplier |
N/A
|
Mouse monoclonal Cytokeratin 4+5+6+8+10+13+18 antibody (FITC)
|
Buy from Supplier |
N/A
|
A synthetic peptide for use as a blocking control in assays to test for specificity of Sec31a antibody, catalog no. 70R-9307
|
Buy from Supplier |
N/A
|
Transportin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVQKTLAQAMMYTQHPEQYEAPDKDFMIVALDLLSGLAEGLGGHVEQLVA. Rabbit polyclonal Transportin 2 antibody.
|
Buy from Supplier |
N/A
|
ELISA Kit for detection of IL6 in the research laboratory
|
Buy from Supplier |